SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003698 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000003698
Domain Number 1 Region: 18-196
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.66e-73
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000012
Further Details:      
 
Domain Number 2 Region: 191-323
Classification Level Classification E-value
Superfamily E set domains 3.97e-51
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003698   Gene: ENSCJAG00000002037   Transcript: ENSCJAT00000003896
Sequence length 537
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:11:121354650:121366600:-1 gene:ENSCJAG00000002037 transcript:ENSCJAT00000003896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAINQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLLPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVFMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSASIPKPGKDFLLSHWSDRFSSI
QPMAEMPSGREMSRGTDLSNRCLKPALLWAYVSQGVGSGDDGDVARTGPYRRVSPPAPQP
YPFSPSLNTINYDEFPTMALLGNSTDPAVFTDLASVDNSEFQQLNQSLPVAPHTAEPMLM
EYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
Download sequence
Identical sequences F7GP67
ENSCJAP00000003698 ENSCJAP00000003698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]