SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000003818 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000003818
Domain Number - Region: 153-195
Classification Level Classification E-value
Superfamily Globin-like 0.0443
Family Globins 0.037
Further Details:      
 
Domain Number - Region: 63-189
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.0879
Family Dehydroquinate synthase, DHQS 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000003818   Gene: ENSCJAG00000002113   Transcript: ENSCJAT00000004022
Sequence length 206
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:9619746:9682612:-1 gene:ENSCJAG00000002113 transcript:ENSCJAT00000004022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILVCDRVSEDGINRQKAQEWCIKHGFELVELSPEELPEEDDDFPESTGVKRIVQALNAN
VWSNVVMKNDRNQGFSLLNSLTGTNHSIGSADPCHSEQPHLPAAESTASLSDHLGGASNT
ADAQVDNLVDPMLDLDIQELASLTTGGGDMENFERLFSKLKEMKDKAATLPHEQRKLHAE
KVAKAFWMAIGGDRDEIEGLSSDEEH
Download sequence
Identical sequences F7GZ46
ENSCJAP00000003818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]