SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004257 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000004257
Domain Number - Region: 113-190
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0516
Family Phosphate binding protein-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004257   Gene: ENSCJAG00000002364   Transcript: ENSCJAT00000004488
Sequence length 220
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:10:21951186:21977034:1 gene:ENSCJAG00000002364 transcript:ENSCJAT00000004488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFQGQRGWFCGSVSRDLRQFWVAEGGTISDPRAADFLFSSDASHPDTLRIYQSLDYIEDN
ATVFHAYYLSAVANAEIKNSVALGHFILPPACLQKEIRRKIGSFIWEQDQHFLIEKHDEV
TANEIKALRESRELATEHKKELSKSTEKHFIRTPAVEKQMYFPLQNYPVNNMVTGYIAID
AMKKFLGELHDFIPGSSGYLAYHVQNEINMSAIKNKLKRK
Download sequence
Identical sequences F6Y512
ENSCJAP00000004257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]