SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004334 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004334
Domain Number 1 Region: 23-142
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.000000000000021
Family Antibiotic resistance proteins 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004334   Gene: ENSCJAG00000002393   Transcript: ENSCJAT00000004568
Sequence length 148
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:47396131:47412004:1 gene:ENSCJAG00000002393 transcript:ENSCJAT00000004568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRTSEKQSWRDSSQTPPPSLICRLDHIVMTVKSIKDTTMFYSKILGMEVTTFKDDRKY
LKLLNREILVQFMGSGWESGATGCCLGGAKGCCVVALLILKMMSSRRTCDVPIEEGPVPR
TGAKGPIMSIYFRDPDRNLIEVSNYISS
Download sequence
Identical sequences F7CKP7
ENSCJAP00000004334 ENSCJAP00000004334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]