SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004363 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004363
Domain Number 1 Region: 305-375
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.31e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004363   Gene: ENSCJAG00000002378   Transcript: ENSCJAT00000004599
Sequence length 714
Comment pep:novel scaffold:C_jacchus3.2.1:GL286373.1:483544:501485:-1 gene:ENSCJAG00000002378 transcript:ENSCJAT00000004599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLQFVSNQVGEFPDLFSEQLCSSFPGSGGNGGSSGGSSGGGGGGGGGGSSSNGRGSSGG
AVDPAMPRSFSQVPLPSFSPSAASPQAPALQVKVSPTSVSTTPRATPILQPRPQPQPQPQ
AQLQQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQSLVTSSQVQPVTIQQQ
VQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQIIKTDSLVLTTLKTDG
SPVMAAVQNPALTALTTPIQTAALQVPTLVGSNGTILTTMPVMMGQEKVPIKQVPGGVKQ
LEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQ
VNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSEVDLKIEDFNQNVLLMSPPASDSGSQA
GFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVLTFLCLSFNPLTSLLQ
WGGAHDSDQHPNSGSGRSVLSFESGSGGWFDWMMPTLLLWLVNGVIVLSVFVKLLVHGEP
VIRPHSRSSVTFWRHRKQADLDLSRGDFAAAAANLQTCLAVLGRALPTSRLDLACSLSWN
VIRYSLQKLRLVRWLLRKVFQRRRATPATEAGFEDQAKTSARDAALAYHRLHQLHITGKL
PAGSACSDVHMALCAVNLAECAEEKIPPSMLVEIHLTAAMGLKTRCGGKLGFLA
Download sequence
Identical sequences H9KVT5
ENSCJAP00000004363 ENSCJAP00000004363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]