SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004381 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004381
Domain Number 1 Region: 260-330
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.09e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004381   Gene: ENSCJAG00000002378   Transcript: ENSCJAT00000004617
Sequence length 616
Comment pep:novel scaffold:C_jacchus3.2.1:GL286373.1:487552:501485:-1 gene:ENSCJAG00000002378 transcript:ENSCJAT00000004617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLQFVSNQVGEFPDLFSEQLCSSFPGSGGRAVDPAMPRSFSQVPLPSFSPSAASPQAPA
LQVKVSPTSVSTTPRATPIQQTVMITPTFSTTPQTRIIQQPLIYQNAATSFQVLQPQVQS
LVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQVPVLVQPQI
IKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSNGTILTTMPVMMG
QEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVMGTDAKMHKS
GVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDSEVDLKIEDFNQN
VLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDRSRILLCVL
TFLCLSFNPLTSLLQWGGAHDSDQHPNSGSGRSVLSFESGSGGWFDWMMPTLLLWLVNGV
IVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLSREVYGKDSESTYSIEELNIHI
SGGTRTRTLLSSRRFCSCCRQPANLPGSFGPGTAHLPPGPGLQPLLERDPLQPAEATPGA
LAAQESFPAPAGHTSD
Download sequence
Identical sequences H9KVT6
ENSCJAP00000004381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]