SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004416 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004416
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 7.59e-23
Family LEM domain 0.0000612
Further Details:      
 
Domain Number 2 Region: 107-155
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000327
Family LEM domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004416   Gene: ENSCJAG00000002421   Transcript: ENSCJAT00000004652
Sequence length 345
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:88597045:88629375:1 gene:ENSCJAG00000002421 transcript:ENSCJAT00000004652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKEKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSK
GSPDFSSDEEREPTPVLGSGAGAAGRSRAAVGRKATKKTDKPRQDDKDDLDVTELTNEDL
LDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTVSSSAESTRQNGSNDS
DRYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQVGEKTEERRVERDILKEMF
PYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGR
SIPVWIKILLFVVVVVFLFLVYQAMETNQVNPFSNFLSVNATKSN
Download sequence
Identical sequences F6YNQ0
XP_003733873.1.60252 ENSCJAP00000004416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]