SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004635 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004635
Domain Number 1 Region: 17-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000968
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000004635
Domain Number - Region: 82-121
Classification Level Classification E-value
Superfamily Orange domain-like 0.000209
Family Hairy Orange domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004635   Gene: ENSCJAG00000002549   Transcript: ENSCJAT00000004888
Sequence length 162
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:36976644:36978120:-1 gene:ENSCJAG00000002549 transcript:ENSCJAT00000004888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGVAPPPSAKATAAAARQPACGLWRPW
Download sequence
Identical sequences F6YLR5
XP_002750255.3.60252 ENSCJAP00000004635 ENSCJAP00000004630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]