SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004650 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004650
Domain Number 1 Region: 43-99
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000157
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 2 Region: 107-159
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000288
Family Hairy Orange domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004650   Gene: ENSCJAG00000002556   Transcript: ENSCJAT00000004905
Sequence length 328
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:74060574:74075197:-1 gene:ENSCJAG00000002556 transcript:ENSCJAT00000004905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPKEPSGSECECDGPADVGQEGELSQMARSLSTPSPSQMQARKXXXXIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFF
HSCPGLPALSNQLTILGRVPGPVLPGASSPAYPIPALRTAPIRRATGIILPARRNLLPSR
GASSTRRARPLERPAAPVPVAPSSRAARSSHITPLLRSSSPTPSGPAGSAAYVAVPTPNS
SSPGPAGRPAGAMLYHSWVSEITEVGAF
Download sequence
Identical sequences F6Y1G0
ENSCJAP00000004650 ENSCJAP00000004656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]