SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004788 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004788
Domain Number 1 Region: 2-112
Classification Level Classification E-value
Superfamily POZ domain 9.42e-29
Family BTB/POZ domain 0.00084
Further Details:      
 
Domain Number 2 Region: 396-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.47e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 441-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.15e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 338-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 303-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.08e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004788   Gene: ENSCJAG00000002629   Transcript: ENSCJAT00000005051
Sequence length 581
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:9141005:9153253:-1 gene:ENSCJAG00000002629 transcript:ENSCJAT00000005051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYSHHCEHLLERLNKQREAGFLCDCTIVIGEFQFKAHRNVLASFSEYFGAIYRSTSENN
VFLDQSQVKADGFQKLLEFIYTGTLNLDSWNVKEIHQAADYLKVEEVVTKCKIKMEDFAF
IANPSSTEISSITGNIELNQQTCLLTLRDYNNREKSEVSTDLVQANPKQGALAKKSSQTK
KKKKPFNSPKTGQNKTVQYPSDILENASVELFLDANKLSTPVGEQVAQINDNSELELTSV
VENTFPAQDIVQTVTVKRKRGKSQPNCALKEHSMSNIASVRSPYEVENSGEELDQRYSKT
KPMCNTCGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKC
ELCDKGFAQKCQLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRC
GQRFAQASTLTYHVRRHTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSF
ISSGELNKHFRSHTGADKTLDSSVEDHTLSEQDSIQKSPLSETMDVKPSDMTLPLALPLG
TEDHHMLLPVTDTQSPTSDTLLRSTVNGYSEPQLIFLQQLY
Download sequence
Identical sequences F7AL96
ENSCJAP00000004788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]