SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000004793 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000004793
Domain Number 1 Region: 107-348
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-24
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000004793   Gene: ENSCJAG00000037831   Transcript: ENSCJAT00000005056
Sequence length 530
Comment pep:novel chromosome:C_jacchus3.2.1:10:20798322:20818893:-1 gene:ENSCJAG00000037831 transcript:ENSCJAT00000005056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAYHQEGQMQLPRADAIRSRLIDTFSLIEHLQGLSQAVPRHTIRELLDPSRQKKLMWED
QQQLLRFSIKPQHTGQISQAQRLLSKLHVRCSHRPPLSLWAGWVLECPLFTNFIIFLIFL
NTIVLMVEIELLESTNTKLWPLKLTLEVAAWFILFIFILEIILMWLSSFSLFWKSAWNVF
DFVVTMLSLLPEVVLLAGVTGQPVWLQFLRICRVLRSLKFFARFRQIRVIILALVRALKS
MTFLLILLLIFFYIFAVAGVYFFAEYTRSPRQDLEYRMFFSDLLNSLVTVFILFTLDHWY
ALLQDTWKVPETSRIFSSIYVILWLLLGSIIFRNIIVAMMVTNFQNIRKELNEEMAHREV
QVKADMFKRQIIQRRKNVSTEALRSTHSKTDDSSRGAIQQKESLDLPEVPEVESIYEATE
EDVITSASKPEETLSKKKEYQSSSNVSSTSSSDASSSESRFSDSVGYLDWETLVHENLPG
LMEMDQDDRVWPRDSLFRYFELLEKLQYNLEERKKLQAFAAQALMNLEDK
Download sequence
Identical sequences B0KWF6
XP_002753430.1.60252 XP_009003579.1.60252 XP_009003580.1.60252 XP_009003581.1.60252 ENSCJAP00000004793 ENSCJAP00000004793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]