SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005008 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005008
Domain Number 1 Region: 480-736
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-33
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 160-315,355-431
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-28
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000005008
Domain Number - Region: 744-823
Classification Level Classification E-value
Superfamily EF-hand 0.00104
Family Polcalcin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005008   Gene: ENSCJAG00000002728   Transcript: ENSCJAT00000005277
Sequence length 1268
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:47846758:47866988:-1 gene:ENSCJAG00000002728 transcript:ENSCJAT00000005277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWNVVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTTKD
KGGDASSHAGNPYLQIQSASAGGRKEEEDGARSEEQARVQDMEEEEEEEEEEEEEGAGGV
ELLQEVVPKEKVIPIPEGSAFFCLSQTNPLRKGCHTLIHHHVFTNLILVFIILSSVSLAA
EDPIRAHSFRNHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNMLDLLVVSV
SLISFGIHSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLL
QFMFACIGVQLFKGKFYTCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFD
NVLSAMMALFTVSTFEGWPALLYKAIDAYAEDHGPIYNYRVEISVFFIVYIIIIAFFMMN
IFVGFVIITFRAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWAAVNSA
AFEYLMFLLILLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYF
TDAWNTFDALIVVGSVVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKG
EGIRTLLWTFIKSFQALPYVALLIAMIFFIYAVIGMQASMFGKVALQDGTQINRNNNFQT
FPQAVLLLFRCATGEAWQEIMLASLPGSRCDPESDFGPGEEFTCGSNFAIAYFISFFMLC
AFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRR
IQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQ
ELRIVIKKIWKRMKQKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGNE
AAPSTSSALQAGLRSLQNLGPEIRQALTCDTEEEEEGQEGVEEEDEKNLETNRATMVSQP
PSRRGSRISVSMPVGDRLPDSLSLGPSEDDRGTPTSSQPSVSQTGSHTYRRGSGALIFTI
PEEGNSQPKGTKGQDEKDEEEEVPDRLSYIDEQTGTPPCPVLLPPHRAQRYMDGHLAPRR
RLLPPTPAGRKPSFTIQCLQRQGSCEDLPIPGTYHRGRNSGPSRAQGSWATPPQRGRLLY
APLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSHGKRGSADSLVEAVLISEGLG
LFARDPHFVALAKQEIADACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRFDEEDLGD
EMACVHAL
Download sequence
Identical sequences F7I3A9
ENSCJAP00000005008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]