SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005022 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005022
Domain Number 1 Region: 92-262,309-380
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1188-1442
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.04e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 532-761
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.2e-29
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 868-1023,1063-1139
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-28
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000005022
Domain Number - Region: 1450-1529
Classification Level Classification E-value
Superfamily EF-hand 0.00131
Family Polcalcin 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005022   Gene: ENSCJAG00000002728   Transcript: ENSCJAT00000005292
Sequence length 1717
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:47850457:47877754:-1 gene:ENSCJAG00000002728 transcript:ENSCJAT00000005292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESEGGKDTTPEPSPANGAGPGPEWGLCPGPPALEGESSGASGLGTPKRRNQHSKHKTV
AVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDVEAEEDPSPCASSGSGRACTMNQTECR
GRWPGPNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKQREKQQMEEDLRGYLDWITQAEELDMEDPS
ADGNLGSLAKEGRAGHRPQLAELTNRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSMTE
TQGDEDDEEGALASCTRCLNKIMKTRVCRRLRRTNRVLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPVWLTQIQEYANKVLLCLFTVEMLLKLYGLGPSAYVSSFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDAGTTKDKGGHAGNPY
LQIQSASRAGGRKEEEDGARSEEQDHPENNRLGMWNVEVKRREGAGGVELLQEVVPKEKV
IPIPEGSAFFCLSQTNPLRKGCHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHSFRNH
ILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNMLDLLVVSVSLISFGIHSSAI
SVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLF
KGKFYTCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALFTV
STFEGWPALLYKAIDAYAEDHGPIYNYRVEISVFFIVYIIIIAFFMMNIFVGFVIITFRA
QGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWAAVNSAAFEYLMFLLILL
NTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYFTDAWNTFDALIV
VGSVVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIK
SFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATG
EAWQEIMLASLPGSRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVIMD
NFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCPHR
VACKRLVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKRMK
QKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGNEAAPSTSSALQAGLR
SLQNLGPEIRQALTCDKNLETNRVRTSFHSPRNLVVKYSSATMVSQPPSRRGSRISVSMP
VGDRLPDSLSLGPSEDDRGTPTSSQPSVSQTGSHTYR
Download sequence
Identical sequences F7I399
ENSCJAP00000005022 ENSCJAP00000005022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]