SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005090 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005090
Domain Number 1 Region: 100-320
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.53e-30
Family Voltage-gated potassium channels 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000005090
Domain Number - Region: 386-495
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.000249
Family Potassium channel NAD-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005090   Gene: ENSCJAG00000002801   Transcript: ENSCJAT00000005363
Sequence length 1130
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:34593644:34740333:1 gene:ENSCJAG00000002801 transcript:ENSCJAT00000005363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVRTKLKEENGKDVAKVSCETEIQLAFLLSSFLIFLSGLIILLIFRLIRGAVKKWQIIRG
TGIILELLTSGSIGKDPVRSLRFQGQFRDCIQMLLSAQTFVGQVLMILVFVLSIGSLIIY
LIKSTDPVRSCLSYEDKTIPIDLAFNAFFSFYFGLRFMAADDKIKFWLEMNSIVDIFTIP
PTFISYYLKSNWLGLRFLRALRLLELPQILQILQVTKTSDSVKFSKLLSVTLSTWFTAAG
VIHLVENSGDPWLEGRNSQTISYFESIYLVVITASTVGFGDVVPKTYLGRICMMIFTLGS
LILFANFMPEMVELFANKRKYTSSYKALKGNKFIVVCGNITVESVTAFLRNFLQLKSGEI
NTEIVFLGETPPSLELETIFKCYLAYTTFISGSAVKQEDLRRVTVESAEACLIIANPLCS
DSHAEDISNIMRVLSIKNYFPTSRVIIQILQSHNKIYLPQIPSWNWNTGDNIICFAELKL
GFIAQGCLVPGLCTLLTSLFVEQNKKVSPKQTWRKDFLNGMKNKILTQRLSDDFAGMSFP
EVARLCFLKMHLLLIAIEYKSLFKDGFCGLILNPPEQVKIHRNTLGFFIAETPKEVKRAL
FYCANCHNNVSIPELITNCGCKSRNRQHSAVPSIKLAEHCIMGFSSRIAAQDSPPREDAK
TTNTPSITARTLLQEAEQDSDQLDSSGMFHWCKTTPLDSVILKRTDKLKHKFQNHIVACV
FGDAHSALVGLRNFVMPLRASNYTQQELKDIVFIGPLDYLQREWQFLQNFPRIYILPGSV
LYPGDFHAANIEQCSMCVVLSPPSKSSSSQTLVDTEAIMATLIIRSLRTDSSSDPSFAMP
ENTPSYTSGPNEKENCQRVPILTELKNPSNIHFIEQLGGLEGSLRKTNLHLSTAFSTGAV
FSGSFLDSLLATAFYNYHVLELLQMLVTGGISSQLEQHLDKDKVYDLSDSCTSLLSGRKR
CKLGLLSLHETILSDVKPRNTFEQLFCGSLDLFGILCVGLYRVIDEEDNNLENKRFVITR
PANDFNLLPSDLVFCAIPFSTACYKRNEETLLQKSEIVNNAPQTTEKYSDTNFPPTIVPG
DETSYSPVYPYKSRSNSPFAKQTSWHQNRTHSVTSSSILSVENAKENGKQ
Download sequence
Identical sequences F7HLZ4
ENSCJAP00000005090 ENSCJAP00000005090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]