SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005224 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005224
Domain Number 1 Region: 332-509,544-710
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.72e-82
Family YicI catalytic domain-like 0.00064
Further Details:      
 
Domain Number 2 Region: 1205-1397,1442-1603
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.95e-73
Family YicI catalytic domain-like 0.00025
Further Details:      
 
Domain Number 3 Region: 88-331
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.39e-48
Family YicI N-terminal domain-like 0.0066
Further Details:      
 
Domain Number 4 Region: 970-1201
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.32e-45
Family YicI N-terminal domain-like 0.009
Further Details:      
 
Domain Number 5 Region: 1606-1686
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.59e-16
Family Putative glucosidase YicI, domain 3 0.015
Further Details:      
 
Domain Number 6 Region: 713-793
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000000018
Family Putative glucosidase YicI, domain 3 0.023
Further Details:      
 
Domain Number 7 Region: 925-982
Classification Level Classification E-value
Superfamily Trefoil 0.000000000122
Family Trefoil 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005224   Gene: ENSCJAG00000002837   Transcript: ENSCJAT00000005507
Sequence length 1826
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:17:13277386:13371974:1 gene:ENSCJAG00000002837 transcript:ENSCJAT00000005507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARRKFSGLEISLIVLFVIVTIIAIALIVVLATKTPAVDEISDSTSTPATTRTTTNPSGS
GRCPNELNDNVNLRINCIPEQFATEETCKQRGCCWRPWNDSLIPWCFFVDNHGYNGEGIT
STDLGLQDTLNRIPSPTLFGNDIGSVSVTTQNQTSSRFRFKITDPNNKRHEVPHQYVKEF
TGPAVSDTLYDVSITENPFSIKVIRKSNGRTLFDTSIGPLVYSDQYLQISTRLPSEYIYG
IGEQVHKRFRHDLYWKTWPIFTRDQLPGDNNNNLYGHQTFFMCIEDPSGESFGVFLMNSN
AMEIFIQPTPIVTYRVTGGILDFYIFLGDTPEQVVQQYQQLVGLPAMPAYWSLGFQLSRW
NYKSLDVVKEVVRRNREAGIPFDTQVTDIDYMENKKDFTYDEVAFQGLPEFVQDLHNNGQ
KYVIILDPAISINQRANGTAYATYERGNAQNVWVNESDGITPIIGEVWPGLTVYPDFTNP
NCIDWWANECSIFHQQVQYDGLWIDMNEVSSFIQGSTKGCNSNNLNYPPFTPDILDKLMY
SKTICMDSVQNWGKQYDVHSLYGYSMAIATEEAVKRVFPNKRSFILTRSTFAGSGRHAAH
WLGDNTASWEQMEWSITGMLEFSLFGIPLVGADICGFEAETTEELCRRWMQLGAFYPFSR
NHNSDGYEHQDPAFFGQNSLLVNSSRHYLTIRYTLLPFLYTLFYKAHMFGETVARPVLHE
FYQDTNSWIEDLEFLWGPALLITPVLKQGADTVSAYIPDAVWYDYESGAKRPWRKQRVDM
YLPADKIGLHLRGGYIIPIQEPDVTTTASRKNPLGLIVALNENNTAKGDFFWDDGETKDI
LQNDNYILYTFSVSDNKLDIVCTHSTYQEGTTLAFKTVKILGLTDTVTQVTVAENNQPIS
AHNNFTYDASNQVLLITDLNLNLGKNFSVQWNQVFSENETFNCYPDADFASEEKCIQRGC
LWRTGSLSKAPECYFPRQDNPYSITSTQYSSMGVTADLQLNPANTRIKLPSDPISTLRVE
VKYHKNDMLQFKIYDPQNKRYEVPVPLNIPTTPISTYENRLYDVEIKENPFGIQIRRRST
GRVIWDSHLPGFAFNDQFIQISTRLPSEYIYGFGEVEHTAFKRDLNWHTWGMFTRDQPPG
YKLNSYGFHPYYMALEEEGNAHSVLLLNSNAMDVTFQPTPALTYRTVGGILDFYMFLGPT
PEVATKQYHEVIGHPVMPPYWALGFQLCRYGYANTSEVIEVYEAMVNASIPYDVQYTDID
YMERQLDFTIGEAFQDLPQFVDKIRGEGMRYIIILDPAISGNETKPYPAFQRGQQEDVFV
KWPNTNDICWAKVWPDLPNITIDKTLTEDEAVNASRAHVAFPDFFRTSTAGWWAREILDF
YNDQMKFDGLWIDMNEPSSFVNGTTSNQCRNDKLNYPPYFPELTKRTDGLHFRTMCMETE
QILSDGSSVLHYNVHNLYGWSQMKPSYDALQKTTGKRGIVISRSTFPTGGRWGGHWLGDN
YARWDNLDKSIIGMMEFSLFGISYTGADICGFFNNSEYHLCTRWMQLGAFYPYSRNHNIA
NTRRQDPASWNETFAEMSRNILNIRYTLLPYFYTQMHEIHAHGGTVIRPLLHEFFSEKPT
WDIFRQFLWGPAFMVTPVLEPYVQSVNAYVPNARWFDYHTSEDIKVREQFHTFNASYETI
NLHVRGGHILPCQEPAQNTFHSRQNYMKLIVAADDNQMAQGFLFWDDGESIDTYERDLYF
YVQFNLNKTILTSTVLKRGYINKNEMMLGVINVWGKGPTPVTAVTLTYNGNTNSLAFSQD
NNKEILTIDLTNYNVTLDEPIEINWS
Download sequence
Identical sequences F7I348
ENSCJAP00000005224 ENSCJAP00000005224 XP_002759467.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]