SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000005505 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000005505
Domain Number 1 Region: 222-259
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000032
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000005505   Gene: ENSCJAG00000004199   Transcript: ENSCJAT00000005809
Sequence length 261
Comment pep:novel chromosome:C_jacchus3.2.1:4:42911062:42960901:-1 gene:ENSCJAG00000004199 transcript:ENSCJAT00000005809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGLRMQLMREQAQQEEQRERMQQQAVMHYMQQQQQQQLGGPPTPAINTPVHFQSPPPVPG
EVLKVQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRA
GHVLSSSAGNSAPNSPMAMLHIGSNPEREFDDVIDNIMRLDDVLGYINPEMQMPNTLPLS
SSHLNVYSSDPQVTASLVGVTSSSCPADLTQKRELTDAESRALAKERQKKDNHNLIERRR
RFNINDRIKELGMLIPKANDL
Download sequence
Identical sequences F7ILU5
ENSCJAP00000005505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]