SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006078 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006078
Domain Number 1 Region: 116-209
Classification Level Classification E-value
Superfamily Kringle-like 1.06e-35
Family Kringle modules 0.000007
Further Details:      
 
Domain Number 2 Region: 210-289
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-34
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 3 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 9.02e-24
Family Hairpin loop containing domain 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006078   Gene: ENSCJAG00000003339   Transcript: ENSCJAT00000006413
Sequence length 290
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:66096913:66123810:1 gene:ENSCJAG00000003339 transcript:ENSCJAT00000006413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGHKKRRNTIHEFKKSAKTTLIKIDPSLKIK
TKKVNTADECANRCTRNRGLPFTCKAFVFDKARKRCLWFPFNSMSNGVRKESGHEFDLYE
NKDYIRNCIIGKGGSYKGTISITKSGIKCQPWSSMVPHEHSFLPSSYRGKDLQENYCRNP
QGEEGGPWCFTSNPEVRYEECDIPQCSEVECLICNGENYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPHTRWEYCAIKTCET
Download sequence
Identical sequences F7GKJ7
ENSCJAP00000006078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]