SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006145 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006145
Domain Number 1 Region: 614-874
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.43e-80
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 498-599
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 3 Region: 280-382
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000572
Further Details:      
 
Domain Number 4 Region: 387-488
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 167-270
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-29
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0016
Further Details:      
 
Domain Number 6 Region: 99-171
Classification Level Classification E-value
Superfamily Kringle-like 1.45e-16
Family Kringle modules 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006145   Gene: ENSCJAG00000003386   Transcript: ENSCJAT00000006485
Sequence length 875
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:3:75233911:75318165:1 gene:ENSCJAG00000003386 transcript:ENSCJAT00000006485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFALALVFGALPEVVGFESVLNDSLHHRPRHSPPPGPLYPHNLPTEQRPRRTRPPP
PLPRFRRPPRALPALRPHALQAGHTPGPHPRGCPAGEPWVSVTDFGAPCLRWAEVPPSLE
RSSPAGWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGSKNEFE
GTVEVYANGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSALGLIPVYWSNVRCR
GDEENILLCEKDIWQGGVCPQKMAAAVMCSFSHGPAFPIIRLVGGSSVHEGRVELYHAGQ
WGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCL
KSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYSGQWGTVCDDGWTELN
TYVVCRQLGFKYGKQASANHFEESAGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHRED
VGIACYPGSEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQ
LGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICD
YFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHRDGRLL
CGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQEIVTHREYRP
DSSDYDIALVRLQGPEEQCARFNSHVLPACLPLWRERPQKTASNCYITGWGDTGQAYSRT
LQQAAIHLLPKRFCEERYKGRFTGRMLCAGNLHQHKHVDSCQGDSGGPLMCERPGESWVV
YGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences F7ERX9
ENSCJAP00000006145 ENSCJAP00000006145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]