SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006156 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006156
Domain Number 1 Region: 495-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-60
Family Eukaryotic proteases 0.00000000506
Further Details:      
 
Domain Number 2 Region: 116-210
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-35
Family Kringle modules 0.000007
Further Details:      
 
Domain Number 3 Region: 210-297
Classification Level Classification E-value
Superfamily Kringle-like 1.38e-34
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 4 Region: 301-384
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-31
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 380-477
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-28
Family Kringle modules 0.00048
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.16e-23
Family Hairpin loop containing domain 0.0000055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006156   Gene: ENSCJAG00000003339   Transcript: ENSCJAT00000006496
Sequence length 728
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:8:66096916:66169477:1 gene:ENSCJAG00000003339 transcript:ENSCJAT00000006496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGHKKRRNTIHEFKKSAKTTLIKIDPSLKIK
TKKVNTADECANRCTRNRGLPFTCKAFVFDKARKRCLWFPFNSMSNGVRKESGHEFDLYE
NKDYIRNCIIGKGGSYKGTISITKSGIKCQPWSSMVPHEHSFLPSSYRGKDLQENYCRNP
QGEEGGPWCFTSNPEVRYEECDIPQCSEVECLICNGENYRGLMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPHTRWEYCAIKTCADSTMNHTNVPM
ETTECIQGQGEGYRGTVNTIWNGIPCQRWDSQYPHQHDMTPENYKCKDLRENYCRNPDGS
ESPWCFTTDPNIRIGYCSQIPNCDISNGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNENYCRNPDDDAHGPWCYTGNLLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPSRD
LKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLP
NYGCTIPEKTSCSVYGWGYTGLINYNGLLRVAHLYIVGNEKCNQYHQGKVILNESEICAG
VENIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAILNRPGIFVRVAYYAKWIHKII
LTYKVPQS
Download sequence
Identical sequences F7EDL5
ENSCJAP00000006156 ENSCJAP00000006156 XP_002751703.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]