SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006817 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000006817
Domain Number 1 Region: 111-163
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000536
Family Hairy Orange domain 0.00012
Further Details:      
 
Domain Number 2 Region: 49-105
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000981
Family HLH, helix-loop-helix DNA-binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006817   Gene: ENSCJAG00000003761   Transcript: ENSCJAT00000007201
Sequence length 337
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:125948385:125960278:1 gene:ENSCJAG00000003761 transcript:ENSCJAT00000007201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRPCDETTSESDMDETIDVGSENNYSGQSTSSVIRLNSPTTASQIMARKKRRGIIEKRR
RDRINNSLSELRRLVPTAFEKQGSAKLEKAEILQMTVDHLKMLQATGGKGYFDAHALAMD
FMSIGFRECLTEVARYLSSVEGLDSSDPLRVRLVSHLSTCASQREAAAMTSSMAHHHHPL
HPHHWAATFHHLPTALLQPNGLHASESTPCRLSTTSEVPPAHGSALLTATFAHADSALRM
PSTGSVAPCVPPLSTSLLSLSATVHAAAAAATAAAHSFPLSFAGAFPMLPPNAAAAVAAA
TAISPPLSVSATSSPQQTSSGTNSKPYRPWGTEVGAF
Download sequence
Identical sequences A0A2K5S608 F7DGL3
ENSCJAP00000006817 XP_002746973.1.60252 XP_017388831.1.71028 ENSCJAP00000006817

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]