SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000006889 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCJAP00000006889
Domain Number - Region: 6-36
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0353
Family RILP dimerisation region 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000006889   Gene: ENSCJAG00000003786   Transcript: ENSCJAT00000007279
Sequence length 175
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:125375198:125483414:1 gene:ENSCJAG00000003786 transcript:ENSCJAT00000007279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHD
MQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRNSPTFKS
FEERVETTVTSLKTKVGGMNPNGGSFEEVLSSTAHASAQSLAGGSRRTKEEELQC
Download sequence
Identical sequences F7HG55
XP_008993232.1.60252 ENSCJAP00000006889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]