SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007190 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007190
Domain Number 1 Region: 177-272
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 2.75e-30
Family Elongation factor TFIIS domain 2 0.0046
Further Details:      
 
Domain Number 2 Region: 8-96
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.7e-18
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0044
Further Details:      
 
Domain Number 3 Region: 294-352
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000147
Family Transcriptional factor domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007190   Gene: ENSCJAG00000003969   Transcript: ENSCJAT00000007597
Sequence length 358
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:11661763:11665366:1 gene:ENSCJAG00000003969 transcript:ENSCJAT00000007597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGTTVVKMSNKNQIAATASLIEQLMSKRKFEDLGNHLTELETIYVTKEHLQETDVVRVV
YRVLTNCPSVALKKKAKCLLSKWKAVYKETHFKARDSPKLLPVRGNKEENSGLSHDPSYD
ETLGICSSNSLSSQDVAKPSEMIVPENGAIQLKPKEEHFEDGDPESTGKRSSELLDPTPM
RTKCIELLYSALTTSSTDQPRADLWQNFAREIEEHVFTLYSKNIKKYKTCIRSKVANLKN
PKNSHLKQNLFSGTMSPREFAEMSVMEMANKELKQLRASYTESCIQEHYLPQVIDGTQTN
KIKCRRCEKYNCKVTTIARGTLFLPTWVRNSNADEQMMTYVICNECGEQWYHSNWVCL
Download sequence
Identical sequences F6QRD2
ENSCJAP00000007190 ENSCJAP00000007190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]