SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007375 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007375
Domain Number 1 Region: 3-62
Classification Level Classification E-value
Superfamily Macro domain-like 0.0000000000000283
Family Macro domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007375   Gene: ENSCJAG00000004066   Transcript: ENSCJAT00000007794
Sequence length 63
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:42240906:42242797:-1 gene:ENSCJAG00000004066 transcript:ENSCJAT00000007794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPTYENLRKSLEAMKSHCLKNGIIYIFFFRIGCGLDRLQWENVSAMIEEVFEATDIKITV
YTL
Download sequence
Identical sequences F6QYW7
ENSCJAP00000007375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]