SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007458 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007458
Domain Number 1 Region: 400-467
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000101
Family HLH, helix-loop-helix DNA-binding domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007458   Gene: ENSCJAG00000004038   Transcript: ENSCJAT00000007881
Sequence length 511
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:13:93213349:93306191:-1 gene:ENSCJAG00000004038 transcript:ENSCJAT00000007881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYCAYTIPGMGGNSLMYYYNGKAVYAPSASTADYNRDSPGYPSSKPTTSTFPSSFFMQDG
HHSSDPWSSSSGMNQPGYAGMLGNSSHIPQSNSYCSLHPHERLSYPSHSSADINSSLPPM
STFHRSGTNHYSTSSCTPPANGTDSIMANRGSGAAGSSQTGDALGKALASIYSPDHTNNS
FSSNPSTPVGSPPSLSAGTAVWSRNGGQASSSPNYEGPLHSLQSRIEDRLERLDDAIHVL
RNHAVGPSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVA
LRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGD
ENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPEQKAEREKERRMANNARERLR
VRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVILSLEQQVRERNLNPKAACLKRR
EEEKVSSEPPPLSLAGPHPGMGDASNHMGQM
Download sequence
Identical sequences A0A2K5E586 F6TQM9
ENSCJAP00000007458 XP_012319685.1.9421 XP_017818987.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]