SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007663 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007663
Domain Number 1 Region: 7-34,74-148
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.79e-25
Family Voltage-gated potassium channels 0.0037
Further Details:      
 
Domain Number 2 Region: 141-261
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.16e-24
Family Voltage-gated potassium channels 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007663   Gene: ENSCJAG00000004233   Transcript: ENSCJAT00000008101
Sequence length 373
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:54991345:55083808:1 gene:ENSCJAG00000004233 transcript:ENSCJAT00000008101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLSLIVCTFTYLLVGAAVFDALESDHEMREEEKLKAEEIRIKGKYNISSEDYR
QLELVILQSEPHRAGVQWKFAGSFYFAITVITTIGYGHAAPGTDAGKAFCMFYAVLGIPL
TLVMFQSLGERMNTFVRYLLKRIKKCCGMRNTDVSMENMVTVGFFSCMGTLCIGAAAFSQ
CEEWSFFHAYYYCFITLTTIGFGDYVALQTKGALQKKPLYVAFSFMYILVGLTVIGAFLN
LVVLRFLTMNTEDERRDAEERASLAGNRNSMVIHIPEEPRPSRPRYKADVGDLQSVCSCT
CYRSQDYGGRSAAPQNFSAKLAPHYFHSISYKIEEISPSTLKNSLFPSPISSISPGLHSF
TDHQRLMRRRKSV
Download sequence
Identical sequences F6TNM6
ENSCJAP00000007663 ENSCJAP00000007663 ENSCJAP00000032603 XP_017821062.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]