SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007905 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007905
Domain Number 1 Region: 50-296
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.49e-91
Family Carbonic anhydrase 0.0000000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007905   Gene: ENSCJAG00000004353   Transcript: ENSCJAT00000008356
Sequence length 317
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:13917366:13966583:1 gene:ENSCJAG00000004353 transcript:ENSCJAT00000008356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWETMDLVPA
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHIWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVKFENFEDAALEENGLAVI
GVFLKLGKYHKELQKLVDTLPSIKHKDTLVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFQHDY
VLNVQAKPKPATSQATP
Download sequence
Identical sequences F7A852
ENSCJAP00000007905 ENSCJAP00000007905 XP_002762698.1.60252 XP_008987244.1.60252 XP_008987245.1.60252 XP_017823850.1.60252 XP_017823851.1.60252 XP_017823852.1.60252 XP_017823853.1.60252 XP_017823854.1.60252 XP_017823855.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]