SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000007952 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000007952
Domain Number 1 Region: 39-260
Classification Level Classification E-value
Superfamily ClpP/crotonase 6.15e-54
Family Crotonase-like 0.000000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000007952   Gene: ENSCJAG00000004375   Transcript: ENSCJAT00000008403
Sequence length 261
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:88109038:88138345:-1 gene:ENSCJAG00000004375 transcript:ENSCJAT00000008403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRVLCLLRPWRPLWARGCASDGAAGGPEIQVRALAGSNQGITEILMNRPRARNALGNVF
VSELLEALAQLREDRQVRVLLFRSAVKGVFCAGADLKEREQMSEAEVGVFVQRLRGLMND
IASSAILGLIETTRGLLPGAGGTQRLPRCLGVALAKELIFTGRRLSGTQAHALGLVNHSV
AQNEEGDAAYHRARALAQEILPQAPIAVRLGKVAIDRGMEVDIASGMVIEGICYAQNIPT
RDRLEGMAAFREKRPPKFVGE
Download sequence
Identical sequences F6Z962
XP_002750883.1.60252 ENSCJAP00000007952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]