SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008124 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008124
Domain Number 1 Region: 5-226
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.2e-39
Family Voltage-gated potassium channels 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008124   Gene: ENSCJAG00000004480   Transcript: ENSCJAT00000008590
Sequence length 752
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:16:62533720:62591233:1 gene:ENSCJAG00000004480 transcript:ENSCJAT00000008590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNHILQFLIVLGCLILAVLTTFKEYETVSGDWLLLLETFAIFIFGAEFALRIWAAGCCCR
YKGWRGRLKFARKPLCMLDIFVLIASVPVVAVGNQGNVLATSLRSLRFLQILRMLRMDRR
GGTWKLLGSAICAHSKELITAWYIGFLTLILSSFLVYLVEKDVPEVDAQGEEMKEEFETY
ADALWWGLITLATIGYGDKTPKTWEGRLIAATFSLIGVSFFALPAAMGISTSPVLLCTEG
DNRQSHFPRERVVLVSLLSYAAWRYYATNPNRIDLVATWRFYESVVSFPFFRKEQLEAAS
SQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKA
YAFWQSSEDAGTGDPMAEDRGYGNEFPIEDMIPTLKTAIRAVRILQFRLYKKKFKETLRP
YDVKDVIEQYSAGHLDMLSRIKYLQTRIDMIFTPGPPSTPKHKKSQKGSAFTFPSQQSPR
NEPYVARASTSEVEDQSMMGKFVKVERQVQDMGKKLDFLVDMHMQHMERLQVHVTEYYPT
KGTSSPAEVERKEDNRYSDLKTIICNYSETGPPEPPYSFHQVPIDKVSPYGFFAHDPVNP
PRGGPSSAKVQATPSPSATTYAERPTVLPILTLLDSRVSYHSQAELQGPYSDRISPRQRR
SITRDSDTPLSLMSVNHEELERSPSGFSISQDRDDYVFGPNGGSSWMREKRYLAEGETDT
DTDPFTPSGSMPLSSTGDGISDSIWTPSNKPT
Download sequence
Identical sequences F7HWR5
ENSCJAP00000008124 ENSCJAP00000008119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]