SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008130 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008130
Domain Number 1 Region: 307-539
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.18e-35
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 2 Region: 1306-1556
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-34
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 984-1143,1180-1257
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-28
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 4 Region: 6-64,109-187
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.53e-20
Family Voltage-gated potassium channels 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008130   Gene: ENSCJAG00000004458   Transcript: ENSCJAT00000008596
Sequence length 2191
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:12417150:12596233:-1 gene:ENSCJAG00000004458 transcript:ENSCJAT00000008596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIF
AIIGLEFYMGKFHTTCFEEGTDDIQSESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQ
FDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLS
GEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDGEQRHPFDGR
SMRRTTIKKSKSDMGGREGDRDLLSAVVGMCSPFARASIKSAKLENSTFFHKKERRMRFY
IRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMY
GLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWAS
LRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIM
TVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFWAIAVDNLAN
AQELTKDEQEEEEAASQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPAKSVWEQRT
SEMRKQNLLASREALYNEMDPDERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKS
RAAEPTVDQRLGQQRAEDFLQETGRYTXFWEGEAERGKAGDPHRRHVHRQGGSRESRSGS
PRTGADGEPRRHRAHRRPGEDGPEDKAERRARHREGERRRRHRHGAPATYEGDARREDKE
RRHRRRKENQGSGVPVCGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAGPHD
SLGHSGLPQSPAKMGNSTDPGPTPAGPAMATNPQNAASRRTPNNPGNPSNPGPPKTPENS
LIVTNPSGTQTNSAKTARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPPSKDGPKPMP
PYSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNVLRY
FDYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFTGNSKGKDI
NTIKSFRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLF
KGKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLTLFTVSTG
EGWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGD
KMMEEYSLEKNERACIDFAISAKPLTRHMPQNRQSFQYRMWQFVVSPPFEYTIMAMIALN
TIVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGILNYFRDAWNIFDFVTVL
GSITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLI
AMLFFIYAIIGMQVFGNIGIDVEDEDSDEDDFQITEHNNFRTFFQALMLLFRSATGEAWH
NIMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTR
DSSILGPHHLDEYVRVWAEYDPAAWGRMPYLDMYQMLRHMSPPLGLGKKCPARVAYKRLL
RMDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWPNLSQKTL
DLLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQDRTPLMFQRMEPPSPTQE
AGPGQNALPSTQLDPGGALMAHESGLKESPSWVTQRAQEMFQKTGTWSPERGPPTDMPNS
QPNSQSVEMRAMGRDGYSDSEHYLPMEGQGRAASMPRLPAENQRRRGRPRGNNLSTISDT
SPMKRSASVLGPKARRLDDYSLERVLPEENQRHHQRRRDRGHRASERSLGRYTDVDTGLG
TDLSMTTQSGDLPSKERDQERGRPKDRKHPPPPDKDRYAQERPDHGRARARDQRWSRSPS
EGREHMTHRQGSSSVSGSPAPSTSGTSTPRRGRRQLPQTPSTPRPHVSYSPVIRKAGGSG
PPQQQQAVARPGRAATSGPRRYPGPVAEPLAGDRPPMGGHSSGRSPRMERRVPGPARNES
PRACRHGGARWPASGPHVSGPPGPRHHGYYQGSNYKSGRPGSGGGQEGMAGAYTLHPPHK
RGPRAHGLARPRGPGSRKFHEPYSESDDDWC
Download sequence
Identical sequences F7HU80
ENSCJAP00000008130 ENSCJAP00000008130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]