SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008178 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008178
Domain Number 1 Region: 13-170
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 5.49e-49
Family TRAPP components 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008178   Gene: ENSCJAG00000004513   Transcript: ENSCJAT00000008647
Sequence length 181
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:116367906:116407539:-1 gene:ENSCJAG00000004513 transcript:ENSCJAT00000008647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRPAHRRPAYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFL
ARSCVGRCHSYSEITDIIAQVAFKMYLGITPSVTCNNSSRNEFSLILDKNPLVEFVEELP
AGRSSLCYCNLLCGIIRGALEMVHLAADVTFLQDRLKGDSVTEIGITFLKKREEKKYRRK
K
Download sequence
Identical sequences F7IQ32
ENSCJAP00000008178 ENSCJAP00000008178 XP_002746935.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]