SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008322 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008322
Domain Number 1 Region: 12-363
Classification Level Classification E-value
Superfamily UROD/MetE-like 6.63e-118
Family Uroporphyrinogen decarboxylase, UROD 0.0000000000031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008322   Gene: ENSCJAG00000004492   Transcript: ENSCJAT00000008797
Sequence length 367
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:79777459:79780951:1 gene:ENSCJAG00000004492 transcript:ENSCJAT00000008797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANGLGLKGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREERDLER
LRDPTVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMAYMVEGGGSSTMAQAKRW
LYQRPQASHQLLRILTDALIPYLVGQVVAGAQALQLFESHAGHLGPHLFNKFALPYIRDV
AKRVKARLQEAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARERVGKTVT
LQGNLDPCALYASEEEMGQLVKQMLDDFGPQRYIANLGHGLYPDMDPEHVGAFVDAVHRH
SRLLRQN
Download sequence
Identical sequences F7HWR0
XP_002750795.1.60252 ENSCJAP00000008322 ENSCJAP00000008322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]