SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008352 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008352
Domain Number 1 Region: 314-553
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.08e-34
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 998-1160,1197-1274
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.43e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 
Domain Number 3 Region: 1323-1575
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.49e-30
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 4 Region: 1-84,126-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-19
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008352   Gene: ENSCJAG00000004426   Transcript: ENSCJAT00000008831
Sequence length 2161
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:24208549:24555744:-1 gene:ENSCJAG00000004426 transcript:ENSCJAT00000008831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLL
QIGLLLFFAILMFAIIGLEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDW
IGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFV
LNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNA
GTSALEVVLRRATIKRSRTEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGVSYFRHK
ERLLRISIRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLL
EMSLKMYGMGPRLYFHSSFNCFDFGLKIGIIMSQWAVSFEVVWAIFRPGTSFGISVLRAL
RLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDG
TPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTL
LNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRH
HMSMWEPRSSHLRERRRRHHMSVWEQRTSQLRKHMQMSSQEALNREEAPPMNPLNPLNPL
SPLNPLNAHPSLYRRPRAIEGLALGLALEKFDEERISRGGSLKGEGGDRSSTLDNQRTPL
SLGQRELPWLPRSCHGNCDPTQQEAGGGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESS
SASRSRSASQERSLDEAVPAEGEKEHELRGNHSAKEPTIQEERAQDLRRTNSLMLSRGSG
LAGALDEANTPLVLPHPELEVGKDAVLTEQEPEGSSEQALLGDVQLDMGRVISHSEPDLS
CITANTDKAITESTSVTVAIPDVGPLVDSTVVHISNKTDGEASPLKEAEIRDDEEEVENK
KQKKEKRETGKAMVPHSSMFIFSTTNPIRRACHYIVNLRYFEMCILLVIAASSIALAAED
PVLTNSERNKVLRYFDYVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGAL
VAFALANALGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILI
VYKLFMFIFAVIAVQLFKGKFFYCTDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFH
YDNIIWALLTLFTVSTGEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFF
VNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHF
VVSPSFEYTIMAMIALNTVVLMMKYYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGF
LNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIR
ILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLM
LLFRLRSATGEAWQEIMLSCLGEKGCEPDTTAPSGQNENERCGTDLAYVYFVSFIFFCSF
LMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMS
PPLGLGKRCPSKVAYKRLVLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADRQQLD
SELQKETLAIWPHLSQKMLDLLVPMPKASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEE
QKNAPMFQRMEPSSLPQEIIANAKALPYLQQEHVFSRSGRTGYPSMSPLSPQEIFQLACM
DPADDGQFQEQQSLEPEVSEFKSVQPANHGIYLPSDTQEHAGSGRASSMPRLTVDPQVVT
DPSSMRRSFSTIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHK
SDTHRSGGRERGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNQ
QGTGSLSESSIPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHAGSISPPADGSQEG
SPLTSQALESNNACLTESSNSPHPQQGQHISPQRYISEPYLAQHEDSHASDCGEEETLTF
EAAVATSLGRSNTIGSAPPLRHSWQMPNGHYRRRRRGGPGSGMMCGAVNNLLSDTEEDDK
C
Download sequence
Identical sequences F7HTP7
ENSCJAP00000008352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]