SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008393 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008393
Domain Number 1 Region: 475-707
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.16e-37
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1478-1728
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-32
Family Voltage-gated potassium channels 0.026
Further Details:      
 
Domain Number 3 Region: 88-246,288-358
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.24e-32
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 1152-1315,1352-1429
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.81e-32
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008393   Gene: ENSCJAG00000004426   Transcript: ENSCJAT00000008876
Sequence length 2271
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:24209338:24555744:-1 gene:ENSCJAG00000004426 transcript:ENSCJAT00000008876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRKHMQMSSQEALNREEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRAIEGLALGL
ALEKFDEERISRGGSLKGEGGDRSSTLDNQRTPLSLGQRELPWLPRSCHGNCDPTQQEAG
GGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAVPAEGEKEH
ELRGNHSAKEPTIQEERAQDLRRTNSLMLSRGSGLAGALDEANTPLVLPHPELEVGKDAV
LTEQEPEGSSEQALLGDVQLDMGRVISHSEPDLSCITANTDKAITESTSVTVAIPDVGPL
VDSTVVHISNKTDGEASPLKEAEIRDDEEEVENKKQKKEKRETGKAMVPHSSMFIFSTTN
PIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFE
MVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALAAFPRRTNKGRDIKTIKSLRV
LRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCT
DSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQ
HSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSL
EKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKY
YSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIIL
TDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFF
IYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCE
PDTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPH
HLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAE
DMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPK
ASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALP
YLQQEHVSGLSGRTGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLVVTDPSSMRRSFS
TIRDKRSNSSWLEEFSMERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRE
RGRSKERKHLLSPDVSRCNSEERGTQADWESPERRQSRSPSEGRSQTPNQQGTGSLSESS
IPSVSDTSTPRRSRRQLPPVPPKPRPLLSYSSLIRHAGSISPPADGSQEGSPLTSQALES
NNACLTESSNSPHPQQGQHISPQRYISEPYLAQHEDSHASDCGEEETLTFEAAVATSLGR
SNTIGSAPPLRHSWQMPNGHYRRRRRGGPGSGMMCGAVNNLLSDTEEDDKC
Download sequence
Identical sequences F7IPV0
ENSCJAP00000008393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]