SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008497 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008497
Domain Number 1 Region: 20-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 6.54e-21
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 
Domain Number 2 Region: 110-160
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 0.0000000451
Family Glutamine synthetase catalytic domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008497   Gene: ENSCJAG00000004654   Transcript: ENSCJAT00000008986
Sequence length 233
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:23657039:23661550:1 gene:ENSCJAG00000004654 transcript:ENSCJAT00000008986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRKPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPRVHITAVWEQTEPTAGTLWRPIT
VPACMLESRLRGLMPRSCLPSGNFKLDPAKESAWEIISGWPVSSCIVYVKTLE
Download sequence
Identical sequences F7I5X3
ENSCJAP00000008497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]