SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008530 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008530
Domain Number 1 Region: 93-313
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.36e-68
Family Mismatch glycosylase 0.0000255
Further Details:      
 
Domain Number 2 Region: 359-498
Classification Level Classification E-value
Superfamily Nudix 7.1e-28
Family MutY C-terminal domain-like 0.000000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008530   Gene: ENSCJAG00000004634   Transcript: ENSCJAT00000009022
Sequence length 550
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:80150062:80163453:-1 gene:ENSCJAG00000004634 transcript:ENSCJAT00000009022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPLVSRLSRLWVIMRKPRAAVGSGHRKQAASQEQRQKHAKSSSQAKASTPNACAGMISE
CPGAPAGLARQLEEVVLQASVSPYHLFRDIAEVTAFRGSLLSWYDQKKRDLPWRRQAEDE
VDLDRRAYAVWVSEVMLQQTQVATVINYYTRWMQKWPTLQDLASASLEEVNQLWAGLGYY
SRGRRLQEGARKVVEKLGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATSVVDGNVA
RVLCRVRAIGADPSSKLVSQQLWSLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQC
PVQSLCRARQRVKQEQPLASQSLLGSPDIEECAPSTGQCQLCLPPSEPWDQTLGVVNFPR
KASRKPSREESSATCVLEQPRALGGARILLVQRPNSGLLAGLWEFPSVTWEPSEPLQRKA
LLQELQRWAGPLPDTHLRHLGEVVHVFSHIKLTYQVYGLALEGQTPVTTAPPGARWLTRE
EFHTAAVSTAVKKVFRVYEGQQPGTCRGSKRSQVSSPSSRKKPSMGQQVLDDFFRPHIST
DAPSLNSAAQ
Download sequence
Identical sequences F7HWI7
ENSCJAP00000008540 ENSCJAP00000008530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]