SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008540 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008540
Domain Number 1 Region: 76-296
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.2e-68
Family Mismatch glycosylase 0.0000255
Further Details:      
 
Domain Number 2 Region: 342-481
Classification Level Classification E-value
Superfamily Nudix 6.59e-28
Family MutY C-terminal domain-like 0.000000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008540   Gene: ENSCJAG00000004634   Transcript: ENSCJAT00000009032
Sequence length 533
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:7:80150062:80162923:-1 gene:ENSCJAG00000004634 transcript:ENSCJAT00000009032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKPRAAVGSGHRKQAASQEQRQKHAKSSSQAKASTPNGMISECPGAPAGLARQLEEVVL
QASVSPYHLFRDIAEVTAFRGSLLSWYDQKKRDLPWRRQAEDEVDLDRRAYAVWVSEVML
QQTQVATVINYYTRWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGRRLQEGARKVVEKL
GGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQATSVVDGNVARVLCRVRAIGADPSSKL
VSQQLWSLAQQLVDPARPGDFNQAAMELGATVCTPQRPLCSQCPVQSLCRARQRVKQEQP
LASQSLLGSPDIEECAPSTGQCQLCLPPSEPWDQTLGVVNFPRKASRKPSREESSATCVL
EQPRALGGARILLVQRPNSGLLAGLWEFPSVTWEPSEPLQRKALLQELQRWAGPLPDTHL
RHLGEVVHVFSHIKLTYQVYGLALEGQTPVTTAPPGARWLTREEFHTAAVSTAVKKVFRV
YEGQQPGTCRGSKRSQVSSPSSRKKPSMGQQVLDDFFRPHISTDAPSLNSAAQ
Download sequence
Identical sequences F7HTJ9
ENSCJAP00000008540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]