SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008550 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008550
Domain Number 1 Region: 361-475,595-711
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.13e-53
Family Phosphate binding protein-like 0.0000000113
Further Details:      
 
Domain Number 2 Region: 28-343
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.68e-49
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 3 Region: 491-594
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000017
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008550   Gene: ENSCJAG00000004624   Transcript: ENSCJAT00000009042
Sequence length 716
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:51288051:51610534:1 gene:ENSCJAG00000004624 transcript:ENSCJAT00000009042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHIFAFFCTGFLGAVVGANFPNNIQIVCSQFSKGVYAIFGFYERRTVNMLTSFCGALHV
CFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAA
EKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGY
HYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRP
KYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRF
EGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN
RTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGA
RDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKP
GVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEELEEGRDQTTSDQSNEFG
IFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSP
IESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIR
VRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRTRQVL
Download sequence
Identical sequences F7HTC7
ENSCJAP00000008550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]