SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000008793 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000008793
Domain Number 1 Region: 67-173
Classification Level Classification E-value
Superfamily POZ domain 4.12e-22
Family BTB/POZ domain 0.0028
Further Details:      
 
Domain Number 2 Region: 558-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.5e-18
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 357-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000671
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 4 Region: 516-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000296
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 462-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000014
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000008793
Domain Number - Region: 419-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0037
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 206-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0833
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000008793   Gene: ENSCJAG00000004794   Transcript: ENSCJAT00000009295
Sequence length 626
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:18509325:18563585:-1 gene:ENSCJAG00000004794 transcript:ENSCJAT00000009295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKRRKVSSNLEKIHLGYHKDSSEGNVAVECDQVTYTHSAERPTPEALHCYQELPPSPDQ
RKLLSSLQYNKNLLKYLNDDRQKQPSFCDLLIIVEGKEFSAHKVVVAVGSSYFHACLSKN
PSTDVVTLDHVTHSVFQHLLEFLYTSEFFVYKYEIPLVLEAAKFLDIIDAVKLLNNENVA
PFQSELTEKSSPEETLNELTGRLSNNHQCKFCSRHFCYKKSLENHLAKNHRSLLLGKKHG
LKMLERSFSARRSKRNRKCPVKFDDTSDDEQESGDGSDNLNQENFDKEKSDRNDSEDPGS
EYNAEEDELEEEMSDEYSDIEQSEKDHNDAEEEPEAGDSVGNIHEGLTPVVIQNSNKKIL
QCPKCDKTFDRIGKYESHTRVHTGEKPFECDICHQRYSTKSNLTVHRKKHSNETEFHKKE
HKCPYCNKLHASKKTLAKHVKRFHPENAQEFISIKKTKSESWKCDICKKSFTRRPHLEEH
MILHSQDKPFKCTYCEEHFKSRFARLKHQEKFHLGPFPCDICGRQFNDTGNLKRHIECTH
GGKRKWTCFICGKSVRERTTLKEHLRIHSGEKPHLCSICGQSFRHGSSYRLHLRVHHDDK
RYECDECGKTFIRHDHLTKHKKIHSD
Download sequence
Identical sequences F7IRZ6
ENSCJAP00000008793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]