SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009136 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009136
Domain Number 1 Region: 60-153
Classification Level Classification E-value
Superfamily FKBP-like 6.54e-29
Family FKBP immunophilin/proline isomerase 0.00000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009136   Gene: ENSCJAG00000004992   Transcript: ENSCJAT00000009654
Sequence length 154
Comment pep:novel chromosome:C_jacchus3.2.1:X:63997740:64007191:1 gene:ENSCJAG00000004992 transcript:ENSCJAT00000009654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPCGLKGLVRQLEQFRVQQQVSKMPPKGKSGSGKAGKGGAASGSDSAEKKAQGPKGGGNA
VKVRHILCEKHSKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEA
AFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK
Download sequence
Identical sequences F7ISJ5
ENSCJAP00000009136 ENSCJAP00000047584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]