SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009223 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009223
Domain Number 1 Region: 128-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.93e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009223   Gene: ENSCJAG00000005011   Transcript: ENSCJAT00000009749
Sequence length 298
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:5:75016001:75020650:1 gene:ENSCJAG00000005011 transcript:ENSCJAT00000009749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESGASPEDPWVKASPVGAHAGEGRVGRACARGGAGRRGASLLSPKSPMLSLPRGCREV
NSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQE
AYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKT
IDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFN
VFQGIMDSLFQSFNASISVTSFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Download sequence
Identical sequences F7IB12
XP_008994892.1.60252 ENSCJAP00000009201 ENSCJAP00000009223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]