SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009228 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009228
Domain Number 1 Region: 31-548
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 1.57e-167
Family Aconitase iron-sulfur domain 0.00000000000000256
Further Details:      
 
Domain Number 2 Region: 555-763
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 1.2e-60
Family LeuD-like 0.00000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009228   Gene: ENSCJAG00000005004   Transcript: ENSCJAT00000009755
Sequence length 782
Comment pep:novel chromosome:C_jacchus3.2.1:1:202208760:202238484:1 gene:ENSCJAG00000005004 transcript:ENSCJAT00000009755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHSLFPLALQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRP
LTLSEKIVYGHLDDPAGQEIERGKTYLRLRPDRVAMQDATAQMAMLQFISSGLPKVAVPS
TIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWRPGSGIIHQIILENYA
YPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWT
SPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYNHR
MKKYLSKTGRADIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHINGPFTPDLAHPVA
EVGKVAEKEGWPVDIRVGLIGSCTNSSYEDMGRSAAVAKQALAHGLKCKSQFTITPGSEQ
IRATIERDGYAQVLRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRNDA
NPETHAFVTSPEIVTALAIAGTLKFNPETDYLMGKDGKKFKLEAPDADELPKAEFDPGQD
TYQHPPKDSSGQHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAAGP
WLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVIGD
ENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHPVD
KLTIQGLKDFTPGKPLKCIIKHPNGTQETILLNHTFNETQIEWKPCWQCPQVPSNRKKEL
QK
Download sequence
Identical sequences F7IB07
ENSCJAP00000009228 ENSCJAP00000044547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]