SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009521 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009521
Domain Number 1 Region: 266-551
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-60
Family Kelch motif 0.00012
Further Details:      
 
Domain Number 2 Region: 2-115
Classification Level Classification E-value
Superfamily POZ domain 1.05e-29
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009521   Gene: ENSCJAG00000005211   Transcript: ENSCJAT00000010063
Sequence length 552
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:X:20039450:20041240:-1 gene:ENSCJAG00000005211 transcript:ENSCJAT00000010063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHGGALLTGYQALRAEGFLCDVTLETEGSEFPAHRSLLACSSDYFRALFKSHTQESRARV
IHLHVPSATGLQRLLDFIYTAWLSLSMDTVEDTLEAASYLQVTEALGLCGRYLERQLAPE
NCCFAANVAARFGLAHTLDAAERCIVRHLRELLGLLELNPTSLRAVLGAPDVARVPEARL
LGLALAWLRQDPAAERLAHCTELLERVRFGLVPAEVLRRVYSGSGLVLPARVKSLIIQAL
NYHTAPSRQPLMQGEQTSIRSPQTRILLVGGRRAREVELTQNVVAFDVYNHRWRSLTHLP
TPLLGHSVCTAGNFLFVLGGESPSGTASSTLTDGPRVVTAQVHRYDPRFHAWTKVPAMRE
ARAHFWCGAVGERLLAVGGLGTGGEALASVEMYDLRRDRWMAAWALPRALHGHAGAVGDR
GVVYISGGKAGRGEGGGSSLRDLYVLGPDEQAWSKRAPMGTARFGHHMAVLRGAVFAFLG
RYEPFSEIERYDPGADQWTRLQPLPYDRFCYGLAVVEETALLLGGLKWRDSRQVPTRNVV
GYDLDLDRWEDI
Download sequence
Identical sequences F7D554
ENSCJAP00000009521 ENSCJAP00000009521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]