SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009624 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009624
Domain Number 1 Region: 44-100
Classification Level Classification E-value
Superfamily Kringle-like 7.42e-18
Family Fibronectin type II module 0.0037
Further Details:      
 
Domain Number 2 Region: 13-56
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000000000657
Family Fibronectin type II module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009624   Gene: ENSCJAG00000005262   Transcript: ENSCJAT00000010170
Sequence length 100
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:22:39833960:39837657:-1 gene:ENSCJAG00000005262 transcript:ENSCJAT00000010170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ETITHFPEIRDGECVFPFYYKNGTHYDCIKTKAKHKWCSLNRTYEGRWKYCAAEDFASCV
FPFWYRRLIYWECTDEGNAFGRKWCSLTQNFNKDRVWKYC
Download sequence
Identical sequences F7GBI3
ENSCJAP00000009624 ENSCJAP00000009624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]