SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009728 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009728
Domain Number 1 Region: 970-1279
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.14e-93
Family Complement components 0.0000183
Further Details:      
 
Domain Number 2 Region: 1352-1484
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.44e-42
Family Alpha-macroglobulin receptor domain 0.000000306
Further Details:      
 
Domain Number 3 Region: 798-918
Classification Level Classification E-value
Superfamily E set domains 1.68e-33
Family SVA-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009728   Gene: ENSCJAG00000018648   Transcript: ENSCJAT00000010278
Sequence length 1489
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:21302484:21352771:-1 gene:ENSCJAG00000018648 transcript:ENSCJAT00000010278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKNKLLHLSLVLLLVLLPTEASDSGKPQYMVLVPSLLHTETAEKCCILMSYLKETVTVS
ASLESIRGNSSLFTDLVAETDVLHCVAFSVPKISSSEEVMFLTVQVKGPTQEFKKRTSVI
VKNDESLVFVQTDKSIYKPGQTVKFRVVSLDETFHPLNELIPLVYIQDPKGNRIAQWQSL
ELEGGLKQLSFPLSSEPFQGSYKVVVQKESGGRREHPFTVEEFVLPKFEVQVNHLPDLVC
SVEKSLRFRICRDRYTYGKPVPGHVTVSVCRKYNDASDCFGEESQVYCEKFSGQLNSHGC
FSRQLKTKVFQLKRKEYEMKLHTEAKIQEEGTEVELTGRETSEITRTVTKLSFVKVDSNF
RQGIPFFGQVRLVDGKGVPMPNKVVLIRANEANHHSNATTDEHGLVQFSINTTNVMGTSL
SVRVRYKDRHPCYTYQWVLEENEEAQHIAHLVFSPSKSFVHLEPIPHELPCGQTQRIQAH
YILKGDVLQGLKKFTFYSVIMAKGGIVHTGTYGLFVKEGDMKGHFSISIPVKSDFAPVAR
LLIYAILPTGDVVGDSAKYKVENCLANKVDLSFRPSQSLPASQAHLQVTAAPQSVCALRA
VDQSVLLMNTESELSTSSVYDLLPVKDLTGFPEYLNDHDDGDCINRHNIFVNGITYSPVS
STNEKDMYSFLRDMGLKALTNSKIHKPNICSRPEPLAMYAPEGLRRAHYGKQEINKYVLP
NILRYNVTKINTKKDLPPHTETIRKYFPETWIWDLVVVNSAGEAEVEVTVPDTITEWKAG
AFCLSKDAGLGISPTASLQAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRVSVQL
EVSPAFLAVPVEKEQGPHCICVNGRQTVSWAITPKSLGNVNFTVSAEALESQELCGTEVT
SVPEYGKKDTIIKPLLVEPEGLEKETTFNSLLCPSGGEVSEELSLKLPPNVVEESARASV
SVLGDILGSAMQNTQNLLQMPYGCGEQNMVLFAPNIYVLDYLNKTQQLTPEIKSKAIGYL
NTGYQRQLNYKHSDGSYSTFGEQHGRNPGNTWLTAFVLKTFAQARAYIFIDEAHINQAFT
WLSQKQKDTGCFRSSGSLLNNAIKGGVEDEVTLSAYVTIALLEIPIPVSNHVVRNALFCL
ESAWKMAQEGASGSHVYTKALLAYAFALAGNQDKEKEVLESLNEEAVKKDNSVHWERPQK
PKAPVGHFYQPQAPSAEVEMTSYVLLAHLTAQPAPSSEDLTAATNIVKWITKQQNSQGGF
SSTQDTVVALHALSKYGAATFTKSGKAAQVTVIQSSGTFSKNFQVDNDNRLLLQQVSLPQ
LPGEYSTKVTGEGCVYLQTSLKYSILPEKEEFPFALEVHTLPQTCDEPKARTSFEISLNV
SYTGSRSASNMAIADVKMISGFIPLKPTVKMLERSNHVSRTEVNNNHVLIYLDKVSNQTL
SLSFTVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKELHRRNM
Download sequence
Identical sequences F7H1W5
ENSCJAP00000009728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]