SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009758 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009758
Domain Number 1 Region: 365-598
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 2 Region: 2-134,183-254
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.22e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 742-895,935-1013
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.87e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 1147-1337
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.02e-25
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 5 Region: 1059-1143
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000133
Family Voltage-gated potassium channels 0.04
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000009758
Domain Number - Region: 1342-1489
Classification Level Classification E-value
Superfamily EF-hand 0.0184
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009758   Gene: ENSCJAG00000000732   Transcript: ENSCJAT00000010310
Sequence length 1996
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:9:14070188:14315267:1 gene:ENSCJAG00000000732 transcript:ENSCJAT00000010310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKAD
GANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVI
IIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCRPGWDGP
KHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNL
VLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEE
KPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRA
AVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLG
LQAYFVSLFNRFDCFVVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSN
LVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTV
FQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADA
ESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEESKEEKIELKSITADGESPPTT
KINMDDLQPNENEDKSPYPNPETTGEDDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASA
FFIFSSNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYV
FTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRV
LRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCS
DSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPE
LLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKN
CELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQ
HYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVI
LSETNHYFCDAWNTFDALIVVGSIVDIAITEVNNAEENSRISITFFRLFRVMRLVKLLSR
GEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTF
PQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYML
CAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLR
RIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQAN
EELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGK
PSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGL
FGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDSTFTPSSYSSTG
SNANINNANNTALGRLPRPTGHPSTVSTVEGHGPPLSPAIRVQEVAWKLSSQRCHSRESQ
TAVVGQEETSQDETYEVKMNDDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQS
PKRGFLRTASLGRRASFHLECLKRQKDRAGDISQKTVLPLHLVHHQALAVAGLSPLLQRS
HSPASFPRPFATPPATPGSRGWPPQPIPTLRLEGAESIEKLNSSFPSIHCGSWAETTPCG
GGSSAARRARPVSLTVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQE
LADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDLAGGEEDAGCVLARGR
LSEEELQDSRVYVSSL
Download sequence
Identical sequences F7GWU8
ENSCJAP00000009758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]