SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000009782 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000009782
Domain Number 1 Region: 1117-1200,1232-1384
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.65e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 431-665
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-34
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 51-221,271-341
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.38e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 798-953,993-1071
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-32
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSCJAP00000009782
Domain Number - Region: 1389-1539
Classification Level Classification E-value
Superfamily EF-hand 0.000917
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000009782   Gene: ENSCJAG00000005329   Transcript: ENSCJAT00000010335
Sequence length 1717
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:19:22645917:22727922:-1 gene:ENSCJAG00000005329 transcript:ENSCJAT00000010335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSSPQDEGLRKKQPKKPAPEILPRPPRALFCLTLQNPLRKACIDIVEWKPFETIILLT
IFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRS
GWNVLDFTIVFLGVFTVILEQVNVIQSNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFTGTDIVATVENE
EPSPCARTGSGRRCTINGSECQGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLD
EDLRGYMSWITQGEVMDVEDFREGKLSLDEGGSDTESLYEIAGLNKVIQFIRHWRQWNRI
FRWKCHDIVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDIANRVLLSLFTIEML
MKMYGLGLRQYFMSIFNRFDCFVVCSGILEVLLVEVGAMTPLGISVLRCIRLLRIFKITK
YWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALISVFQVLTGEDWTSMMYNGIMAYGGPAYPGVLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEEKSTMAKKLEQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRILCHRIVNATWFTNFILLFIMLSSAALAAEDPIRAESTRNQILKHFDVGFT
SVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLR
VLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDL
SKMTEEECRGYYYVYKDGDPEQIELHHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDSNGEDVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLKCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILS
EIDVSISGEGGLSFMGQAVGGTDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEILLACSYGKLCDPESEYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDIVQIQAGLR
TIEEEAAPEIRRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPP
VMANQRPLQFAEIEMEELESPVFLEDFPQDPRTNPLARANTNNANANVVYGNSSHSNSHV
LSSVHFEMEFPEETETPAARGGAPGQPCRALGPHGKP
Download sequence
Identical sequences F7GWQ4
ENSCJAP00000009776 ENSCJAP00000009782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]