SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010338 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010338
Domain Number 1 Region: 430-636
Classification Level Classification E-value
Superfamily Kelch motif 9.68e-65
Family Kelch motif 0.00000468
Further Details:      
 
Domain Number 2 Region: 328-473
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-35
Family Kelch motif 0.00029
Further Details:      
 
Domain Number 3 Region: 9-127
Classification Level Classification E-value
Superfamily POZ domain 2.08e-28
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010338   Gene: ENSCJAG00000005584   Transcript: ENSCJAT00000010927
Sequence length 642
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:18:20823590:20844771:1 gene:ENSCJAG00000005584 transcript:ENSCJAT00000010927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI
FNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQV
CGDYLLSRMDVSSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISGEEEFLKLPRLKLEV
MLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQ
AEVFGSDDDHIQFVQKKAPRENGHKQISSSSTGCLPSPNATVQSPKHEWKIVASEKTSNN
TYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKPMSPMHYARSG
LGTAEMNGKLIAAGGYNREECLRTVECYDPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV
GGSNGHSDDLSCGEMYDSNVDDWIRVPELRTNRCNAGVCALNGQLYIVGGSDPYGQKGLK
NCDVFDPVTKLWTSCAPLNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWT
LIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMANMTSPRSNAG
IATVGNTIYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQF
Download sequence
Identical sequences F7A9N2
ENSCJAP00000010338 XP_002760301.1.60252 XP_017821916.1.60252 ENSCJAP00000010219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]