SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010354 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010354
Domain Number 1 Region: 33-137
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 7.06e-29
Family NadC C-terminal domain-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010354   Gene: ENSCJAG00000007227   Transcript: ENSCJAT00000010944
Sequence length 150
Comment pep:novel chromosome:C_jacchus3.2.1:12:28151329:28171470:-1 gene:ENSCJAG00000007227 transcript:ENSCJAT00000010944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPSTAPPPGLGPLGALSLSSQHTSPVSCKLPWMLKAVQVARQAADFALKVEVECSSLQEA
VQAAEAGADLVLLDNFKPEELHPTAAALKTQFPSVAVEASGGITLDNLPQFCGPHIDVIS
MGMLTQAAPALDFSLKLFAEEVAPVPKTRW
Download sequence
Identical sequences F6ZS65
ENSCJAP00000010354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]