SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010657 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010657
Domain Number 1 Region: 49-271
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-18
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010657   Gene: ENSCJAG00000005799   Transcript: ENSCJAT00000011257
Sequence length 397
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:2:31741397:31796949:1 gene:ENSCJAG00000005799 transcript:ENSCJAT00000011257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQHRHQSLSKVSSSSLVTTLTEFCPTFKKFKRKDDEFQAFGKRVITSHFFKIIMICAVG
SNAFLTALWTSYDIRYRLFRLLEFSEIFFVSICISELAMKVYVDPTDYWKDGYNVMDVVI
IIIIFLPYTTRRFLGKQFTYLYVADGMQSLRILKIIRYSQGIRMMISAMRQTVYTVASVL
LLLFLLMYIFGILGFCLFGSQDRGDYDNWGNLPVAFFTLFSLATVDGWTDLQKQLDNRGF
ALSRAFTIIFILLASFIFLNMFVGVMIRYTEDSIKKFEQERTLERKMTLMEEKQVILQRQ
QEDISRLMHMQKNADCKSFSELVENFKKTLRHTDPMVLDDFATSLAFIDIYFSTLDYQDM
TIHKLQELYYEIAHVLGLVLEDLPQKKPQSLEKVDEK
Download sequence
Identical sequences F7HWL7
ENSCJAP00000047810 XP_003732249.3.60252 ENSCJAP00000010657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]