SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSCJAP00000010822 from Callithrix jacchus 76_3.2.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCJAP00000010822
Domain Number 1 Region: 78-203
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Domain Number 2 Region: 19-85
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-18
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCJAP00000010822   Gene: ENSCJAG00000005894   Transcript: ENSCJAT00000011431
Sequence length 439
Comment pep:known_by_projection chromosome:C_jacchus3.2.1:4:40227605:40265341:-1 gene:ENSCJAG00000005894 transcript:ENSCJAT00000011431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGLFG
VPLCLTWISALGKFFGGRAKRLGQFLTKRGVSLRKAQITCTVIFIVWGVLVHLVIPPFVF
MVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSLFV
NWKVSMFVEVHKAIKKRRRRRKESFESSPHSRTALQVKGSAASKDVNIFSFLSKKEETYN
DLIKQIGKKAMKTSGGGERGPGPGPGLGPQGGGLPALPPSLAPLVVYSKNRVPSLEEVSQ
TLRSKGHVSRPPGEEVVTRAPEDSSPAPEVFMNQLDRISEECEPWDVQDYHPLIFQDASI
TFVNEEAGLLDEETSKSSLEDNLAGEESPQEGAEAKATLNMGEIPSSDESTFTSTESELS
VPYEQLMNEYNKANSPKGT
Download sequence
Identical sequences F7HYY3
ENSCJAP00000010822 ENSCJAP00000010822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]